PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E00361.1.p
Common NameEUGRSUZ_E00361
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family CAMTA
Protein Properties Length: 223aa    MW: 25138.5 Da    PI: 6.7748
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E00361.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-128.62.4e-0914218276116
              CG-1  76 ggvevlycyYahseenptfqrrcywlLeeelekivlvhyle 116
                        +v+v +cyY+ +++n++ q r++w+ + +le+i +vhy+e
  Eucgr.E00361.1.p 142 SSVDVWHCYYVYGQDNENSQCRSHWMFDGQLEHIGIVHYRE 182
                       689************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143713.21977189IPR005559CG-1 DNA-binding domain
PfamPF038591.1E-6138182IPR005559CG-1 DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MISWKHGISG RTPMRLSSPS IIGERRSLEP IAGRGPRRPC FCACCSVTKS VWSHYEATVR  60
NLRRLSNSRA YGFVLDLEQM LQELGHSRPH RTETCEILWK TRTFNDTRAT PFRPLGSVTS  120
DLILSLSFPA IYSETLIDLA DSSVDVWHCY YVYGQDNENS QCRSHWMFDG QLEHIGIVHY  180
RELNEVVEIE VSAETLTNTS MQCATPAHTP ANVTFSLLAA ID*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E00361.1.p
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010055420.16e-70PREDICTED: calmodulin-binding transcription activator 2-like isoform X1
RefseqXP_010055422.15e-70PREDICTED: uncharacterized protein LOC104443629 isoform X3
RefseqXP_010055423.15e-70PREDICTED: uncharacterized protein LOC104443629 isoform X3
TrEMBLA0A059C1231e-167A0A059C123_EUCGR; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64220.28e-14Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains